Protein Info for BWI76_RS09635 in Klebsiella michiganensis M5al

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details TIGR02868: thiol reductant ABC exporter, CydC subunit" amino acids 7 to 533 (527 residues), 586.9 bits, see alignment E=1.9e-180 PF00664: ABC_membrane" amino acids 24 to 287 (264 residues), 48.8 bits, see alignment E=1.2e-16 PF00005: ABC_tran" amino acids 356 to 502 (147 residues), 117.8 bits, see alignment E=8.8e-38

Best Hits

Swiss-Prot: 83% identical to CYDC_ECOLI: ATP-binding/permease protein CydC (cydC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to eae:EAE_15055)

MetaCyc: 83% identical to glutathione/L-cysteine ABC exporter subunit CydC (Escherichia coli K-12 substr. MG1655)
7.4.2.-; 3.6.3.M9 [EC: 3.6.3.M9]

Predicted SEED Role

"Transport ATP-binding protein CydC" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.M9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1C8 at UniProt or InterPro

Protein Sequence (573 amino acids)

>BWI76_RS09635 amino acid ABC transporter ATP-binding protein (Klebsiella michiganensis M5al)
MRALWPYLALYKRHKWLLLLGIVLAIVTLLASIGLLTLSGWFLSASAVVGVAGIYSFNYM
LPAAGVRGAAIIRTAGRYFERLVSHDATFRVLQHLRVFTFSKLLPLSPAGLARFRQGELL
NRVVADVDTLDHLYLRVISPLVGALVVILVVTVGLSVLDVTLALTLGGIMLLTLLVMPPL
FYRAGKPAGESMTRLRGQYRQQLTSWLQGQAELMLFNASDRYRRQMEKTEAHWLDAQRRQ
AELTALSQALMLLIGGIAVIAMLWLASAGVGGDTQPGALIALFVFCALAAFEALAPVTGA
FQHLGQVIASAKRITQITEQEPEVSFTQGEERKLERVALNLNQVSFSYPQQPSPALEKIS
LQVKAGEHIAILGRTGCGKSTLLQLLTRAWDPAEGEILLNGEPLAQLNEATLRQAMSVVP
QRVHLFSATLRDNLLLASPNASDARLAETLERVGLAKLLDDSGLNSWLGEGGRQLSGGEL
RRLAIARALLHDAPLMLLDEPTEGLDATTESQILDLLAEVMREKTVLMVTHRLRGLARFN
QIIVMDNGKIIEQGSHAELLAEQGRYYQFKQRL