Protein Info for BWI76_RS09610 in Klebsiella michiganensis M5al

Annotation: ATP-dependent Clp protease adaptor ClpS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF02617: ClpS" amino acids 22 to 101 (80 residues), 123.2 bits, see alignment E=1.5e-40

Best Hits

Swiss-Prot: 93% identical to CLPS_KLEP3: ATP-dependent Clp protease adapter protein ClpS (clpS) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_15035)

Predicted SEED Role

"ATP-dependent Clp protease adaptor protein ClpS" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1G0 at UniProt or InterPro

Protein Sequence (105 amino acids)

>BWI76_RS09610 ATP-dependent Clp protease adaptor ClpS (Klebsiella michiganensis M5al)
MSKRDWLDFDQLVEDEVKDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQL
MLTVHYQGKAICGVFTAEVAETKVSMVNQYARENEHPLLCTLEKA