Protein Info for BWI76_RS09595 in Klebsiella michiganensis M5al

Annotation: macrolide transporter subunit MacA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 39 to 362 (324 residues), 185.6 bits, see alignment E=5.6e-59 PF25917: BSH_RND" amino acids 61 to 216 (156 residues), 84.1 bits, see alignment E=1.4e-27 PF25973: BSH_CzcB" amino acids 62 to 210 (149 residues), 30.5 bits, see alignment E=8.2e-11 PF25876: HH_MFP_RND" amino acids 107 to 184 (78 residues), 69 bits, see alignment E=1.1e-22 PF25944: Beta-barrel_RND" amino acids 222 to 300 (79 residues), 92.3 bits, see alignment E=6.1e-30 PF25954: Beta-barrel_RND_2" amino acids 225 to 299 (75 residues), 34 bits, see alignment E=8.1e-12 PF25967: RND-MFP_C" amino acids 305 to 364 (60 residues), 61.8 bits, see alignment E=1.4e-20

Best Hits

Swiss-Prot: 79% identical to MACA_ECO57: Macrolide export protein MacA (macA) from Escherichia coli O157:H7

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 92% identity to kpn:KPN_00911)

MetaCyc: 79% identical to ABC-type tripartite efflux pump membrane fusion protein (Escherichia coli K-12 substr. MG1655)
7.6.2.-; 7.6.2.-; 7.6.2.-

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1B7 at UniProt or InterPro

Protein Sequence (371 amino acids)

>BWI76_RS09595 macrolide transporter subunit MacA (Klebsiella michiganensis M5al)
MKLNGKRRKVWWLLAIVVLALAVWGWRILNAPLPQYQTLVVRKGDLQQSVLATGKLDALK
KVDVGAQVSGQLKTLRVEIGDKVKKDQLLGVIDPEQAENQIKEVEATLMELRAQLNQARA
ERKLSATTLARQQQLAQRQLVSRQDLDTAATDLAVKEAQIGTIEAQVKRNQATLDTAKTN
LDYTKILAPMSGEVTQITTLQGQTVIAAQQAPNILTLADLSTMLVKAQVSEADVIHLKPG
QKAWFTVLGDPLTRYEGTLKDILPTPEKVNDAIFYYARFEVPNPQGILRLEMTAQVHIQL
SEVKNVITLPLSALGDAIGDNRYHVRLLRTGEVKEREIVIGARNDTDVAVVKGLEEGDEV
IIGEGAAGAAK