Protein Info for BWI76_RS09590 in Klebsiella michiganensis M5al

Annotation: ATP-dependent OLD family endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 PF13175: AAA_15" amino acids 1 to 50 (50 residues), 35.7 bits, see alignment 1.6e-12 PF11398: DUF2813" amino acids 1 to 375 (375 residues), 519.4 bits, see alignment E=1.4e-159 PF20469: OLD-like_TOPRIM" amino acids 376 to 440 (65 residues), 58.4 bits, see alignment E=1.7e-19

Best Hits

Swiss-Prot: 85% identical to YBJD_ECOLI: Uncharacterized protein YbjD (ybjD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_15015)

Predicted SEED Role

"Predicted ATP-dependent endonuclease of the OLD family, YbjD subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1Q4 at UniProt or InterPro

Protein Sequence (552 amino acids)

>BWI76_RS09590 ATP-dependent OLD family endonuclease (Klebsiella michiganensis M5al)
MHLERVEIVGFRGINRLSLMLEQNNVLIGENAWGKSSLLDALTLLLSPEFDLYHFVREDF
WFPPGDIQGREHHLHIILTFRENEPGRHRVRRYRPLSNCWVPCDDGYQRVFYRLEGELAD
DDSVMTLRSFINGEGEALELDDIDELARHLVRLMPVLRLRDARFMRRIHNGTVPHSPQIE
ITARQLDFLSRELVHHPQNLTDGQIRQGLSAMVQLLEHYFAEQSSAQSRHRLMRRHSHDE
QRSWRYLDIINRMIDKPGGRSHRVILLGLFSTLLQAKGTVRLDRDARPLLLIEDPETRLH
PIMLSVAWHLLNLLPLQRVTTTNSGELLSLTPVEHVCRLVRESSRVSAWRLGPGGMNAED
SRRIAFHIRFNRASSLFARCWLLVEGETETWVINELARQCGHHFDAEGVKVIEFAQSGLK
PLIKFARRMGIEWHVLVDGDEAGKKYAATVRGLLNDDKMLERDHLTALPAMDMEHFMYRQ
GFDDVYHRVAQLPINIPMNMRRVITKAIHRSSKPDLAIEVAMEAGRRGVDAIPALLKKMF
SRVLWLARGRAD