Protein Info for BWI76_RS09585 in Klebsiella michiganensis M5al

Annotation: aquaporin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details PF00230: MIP" amino acids 2 to 223 (222 residues), 179.6 bits, see alignment E=4.2e-57 TIGR00861: MIP family channel proteins" amino acids 7 to 223 (217 residues), 213.7 bits, see alignment E=1.4e-67

Best Hits

Swiss-Prot: 89% identical to AQPZ_ECO57: Aquaporin Z (aqpZ) from Escherichia coli O157:H7

KEGG orthology group: K06188, aquaporin Z (inferred from 97% identity to cko:CKO_02204)

MetaCyc: 90% identical to water channel AqpZ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-145

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1J4 at UniProt or InterPro

Protein Sequence (231 amino acids)

>BWI76_RS09585 aquaporin (Klebsiella michiganensis M5al)
MFRKLAAECFGTFWLVFGGCGSAVLAAAFPELGIGFAGVALAFGLTVLTMAYAVGHISGG
HFNPAVTLGLWAGGRFPAKEVIGYIIAQVVGGIIAAAILYVVASGKAGFDAAASGFASNG
YGEHSPGGFSMLSAIVIEIVLTCGFLLVIHGATDKNAPAGFAPIAIGLALTLIHLISIPV
TNTSVNPARSTAVAIFQGGWALQQLWLFWVMPIIGGILGGVLYRTLLEKRS