Protein Info for BWI76_RS09520 in Klebsiella michiganensis M5al

Annotation: arginine ABC transporter ATP-binding protein ArtP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF00005: ABC_tran" amino acids 20 to 170 (151 residues), 133.3 bits, see alignment E=9.5e-43 PF13304: AAA_21" amino acids 140 to 202 (63 residues), 32.2 bits, see alignment E=1.1e-11

Best Hits

Swiss-Prot: 95% identical to ARTP_ECOLI: Arginine transport ATP-binding protein ArtP (artP) from Escherichia coli (strain K12)

KEGG orthology group: K10000, arginine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 95% identity to ecc:c0997)

MetaCyc: 95% identical to L-arginine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Arginine ABC transporter, ATP-binding protein ArtP" in subsystem Arginine and Ornithine Degradation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B197 at UniProt or InterPro

Protein Sequence (242 amino acids)

>BWI76_RS09520 arginine ABC transporter ATP-binding protein ArtP (Klebsiella michiganensis M5al)
MSIKLNGINCFYGAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLH
IAGNHFDFTKAPSDKAIRELRQNVGMVFQQYNLWPHLTVQQNLIEAPCRVLGLSKDRALD
RAEKLLERLRLKPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQI
VSIIRELAETGITQVIVTHEVEVARKTASRVVYMENGHIVEQGDAGCFAHPQTDAFKNYL
SH