Protein Info for BWI76_RS09495 in Klebsiella michiganensis M5al

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 179 to 203 (25 residues), see Phobius details PF00512: HisKA" amino acids 268 to 336 (69 residues), 65.3 bits, see alignment E=4.2e-22 PF02518: HATPase_c" amino acids 384 to 489 (106 residues), 71.7 bits, see alignment E=6.9e-24

Best Hits

KEGG orthology group: None (inferred from 84% identity to eae:EAE_14910)

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B196 at UniProt or InterPro

Protein Sequence (490 amino acids)

>BWI76_RS09495 sensor histidine kinase (Klebsiella michiganensis M5al)
MIRRLSLSQRLALVFTSLLLLCSIAVCLIQLYSSAQYGNVMVQRLSAGLAQQIAAREPLL
DAQGQVDRQMLKPLFDRLMTFNPSVELYLLSPDGELLADAAPPGHIKRQRIDLAPVQTFL
SGGAWPVYGDDPRSLDKQKVFSVAPLRQDGQLRGYLYIILQGETFNELAASAWQKTLWSL
LLWTLLLVAGLGGLAGWLAWFWVTRPVRQLTALVATDSQDSIHAIKALAAQTPEANPGNE
VAVLHNRFIELARQIASQWDRLADSDRQRREFVANISHDLRTPLTSLLGYLETLSLKADR
LTMEENKQYLNIALRQGNKVRHLSQQLFELARLEHGGIKPQPETFVLAELVQDVAQKFDL
PIATRNIGLRLELATGLPPITADLSMIERVLTNLLDNAIRHTPEGGLIRLAARRSGPEFI
VEVADSGPGIGSELRATLFERPSVLAPGAQSASRGGLGLMIVRRMLQLHGGDIRLLDAPA
GACFQFTLPV