Protein Info for BWI76_RS09485 in Klebsiella michiganensis M5al

Annotation: 23S rRNA (uracil(747)-C(5))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 TIGR02085: 23S rRNA (uracil-5-)-methyltransferase RumB" amino acids 2 to 374 (373 residues), 683.9 bits, see alignment E=2.9e-210 PF05958: tRNA_U5-meth_tr" amino acids 208 to 374 (167 residues), 59.8 bits, see alignment E=3.8e-20 PF05175: MTS" amino acids 235 to 311 (77 residues), 27.4 bits, see alignment E=3.6e-10 PF13847: Methyltransf_31" amino acids 236 to 307 (72 residues), 32.9 bits, see alignment E=7.2e-12

Best Hits

Swiss-Prot: 85% identical to RLMC_CITK8: 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC (rlmC) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: None (inferred from 86% identity to eae:EAE_14900)

MetaCyc: 82% identical to 23S rRNA m5U747 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11600 [EC: 2.1.1.189]

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase rumB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.189

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1H6 at UniProt or InterPro

Protein Sequence (376 amino acids)

>BWI76_RS09485 23S rRNA (uracil(747)-C(5))-methyltransferase (Klebsiella michiganensis M5al)
MHCALYDAGRCRSCQWLELPISQQLADKMADLRALLADAPVAEWCAPACGPESGFRNKAK
MVVSGSVERPLLGMLHRDGAPEDLTDCPLYPQSFAPVFAALKPFIARAGLTPYHVARRRG
ELKYILLTESRLDGGMMLRFVLRSETRLTQLRAALPALQALLPQLKVITANIQPVHMAIM
EGPQEIFLTDQQALAENFNGVPLWIRPQSFFQTNPTVASRLYATARDWVRQLPVNHMWDL
FCGVGGFGLHCASPEMRLTGIEIAPEAIACAKQSAAELGLHNLHFQALDSTQFATGEGEI
PDLVLVNPPRRGIGDELCAYLSRMAPEFIIYSSCNARTMAKDIARLSGYRIERVQLFDMF
PHTAHYEVLTLLVREV