Protein Info for BWI76_RS09450 in Klebsiella michiganensis M5al

Annotation: 30S ribosomal protein S6--L-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF18030: Rimk_N" amino acids 1 to 94 (94 residues), 135.9 bits, see alignment E=1.5e-43 TIGR00768: alpha-L-glutamate ligase, RimK family" amino acids 2 to 286 (285 residues), 309.8 bits, see alignment E=8.6e-97 PF02655: ATP-grasp_3" amino acids 97 to 263 (167 residues), 35.8 bits, see alignment E=2.6e-12 PF08443: RimK" amino acids 97 to 286 (190 residues), 268.1 bits, see alignment E=1.1e-83 PF02955: GSH-S_ATP" amino acids 118 to 264 (147 residues), 61.1 bits, see alignment E=3e-20 PF07478: Dala_Dala_lig_C" amino acids 130 to 267 (138 residues), 29.3 bits, see alignment E=1.8e-10

Best Hits

Swiss-Prot: 94% identical to RIMK_KLEP3: Probable alpha-L-glutamate ligase (rimK) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_14865)

MetaCyc: 88% identical to ribosomal protein S6 modification protein (Escherichia coli K-12 substr. MG1655)
6.3.2.-

Predicted SEED Role

"Ribosomal protein S6 glutaminyl transferase" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1E0 at UniProt or InterPro

Protein Sequence (300 amino acids)

>BWI76_RS09450 30S ribosomal protein S6--L-glutamate ligase (Klebsiella michiganensis M5al)
MKIAILSRDGTLYSCRRLREAAQKRGHQVEILDPLSCYMNVSPVASSIHYKGRQLPHFDA
VIPRIGTAITYYGTAALRQFELLGSYPLNESVAITRARDKLRSLQLLARQGIDLPLTGIA
HSPDDTSDLIAMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVIDAFRGLNAHILVQEYI
AEAKGRDVRCLVVGNEVVAAIERRAKEGDFRSNLHRGGVASVAFISEQEREMAIKAAQTL
GLDVAGVDILRATRGPLVMEVNASPGLEGIETTTGVDIAGKMIAWIERQATPGFCLKMGG