Protein Info for BWI76_RS09325 in Klebsiella michiganensis M5al

Annotation: putative bacteriophage tail completion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF05069: Phage_tail_S" amino acids 3 to 146 (144 residues), 139.3 bits, see alignment E=4.6e-45 TIGR01635: phage virion morphogenesis protein" amino acids 3 to 133 (131 residues), 115.8 bits, see alignment E=8.6e-38

Best Hits

Swiss-Prot: 40% identical to VPS_BPP2: Tail completion protein S (S) from Escherichia phage P2

KEGG orthology group: None (inferred from 79% identity to stt:t4310)

Predicted SEED Role

"Phage tail completion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>BWI76_RS09325 putative bacteriophage tail completion protein (Klebsiella michiganensis M5al)
MAELQEVDAWLDALLAALEPAERKRMMRELAQQLRRSQQKNIRMQRNPDGTEYEPRRVTA
RTKTGRIRRQMFAKLRTAKYLKAVASPDSASVEFEGRVQRIARVHHYGLRDRVSRRGPEV
QYSQRRLLGINDEVEDITRDTFLRWLSD