Protein Info for BWI76_RS09305 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 transmembrane" amino acids 5 to 24 (20 residues), see Phobius details amino acids 35 to 57 (23 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details PF28015: LysA" amino acids 1 to 122 (122 residues), 152.9 bits, see alignment E=2.4e-49

Best Hits

KEGG orthology group: None (inferred from 46% identity to sea:SeAg_B2860)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (127 amino acids)

>BWI76_RS09305 hypothetical protein (Klebsiella michiganensis M5al)
MKKKLISGLLSVLYAALMILSLFVPNGMASALVTALTWVACLLVWVVVLLCLTGWYAGGT
HREEARQALTRFFSTPGNQVIRWARRSLLVIFLAFTGHVVTLAFYLLTLVALKVLRAQVV
DAESVTV