Protein Info for BWI76_RS09240 in Klebsiella michiganensis M5al

Annotation: phosphoadenosine phosphosulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF01507: PAPS_reduct" amino acids 16 to 237 (222 residues), 124.3 bits, see alignment E=2.7e-40

Best Hits

Swiss-Prot: 83% identical to CP84_BP186: Uncharacterized 37.8 kDa protein in gpa 5'region (CP84) from Escherichia phage 186

KEGG orthology group: None (inferred from 98% identity to ent:Ent638_1349)

Predicted SEED Role

"Uncharacterized 37.8 kDa protein in gpa 5'region"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>BWI76_RS09240 phosphoadenosine phosphosulfate reductase (Klebsiella michiganensis M5al)
MNIIDPRCFAANTINTISISGGKDSLAQWLRAIENDAPHLSVFADTGHEHPQTMDYLDYL
ESRLGKVIRVKADFTRQIEGKRKFISEKWPVSLVEECGMSPDEAAERIHRALEILKPTGN
PFLDLCMWKGRFPSTKARFCTFDLKHEPVRTQVIVPALEEYDEVISWQGVRAQESPARAL
LPEWEEDADNTPGLHVYRPILNWQHEDVFAIAKRHGIKPNPLYLQGCSRVGCMPCIHARK
SELAEIFQRWPEEIRRVAEWERMVAECSRRGNSTFFPSTHDPRRAEKRIEVITVDGYGIE
TYRDWALTTRGGAQFDLLAGTNDSAVCSSVYAGVCE