Protein Info for BWI76_RS09185 in Klebsiella michiganensis M5al

Annotation: integrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF24624: Int_N" amino acids 57 to 165 (109 residues), 104.8 bits, see alignment E=3.6e-34 PF00589: Phage_integrase" amino acids 174 to 245 (72 residues), 38.2 bits, see alignment E=1.3e-13 amino acids 280 to 321 (42 residues), 41.8 bits, see alignment 1.1e-14

Best Hits

Swiss-Prot: 50% identical to VINT_BPHC1: Integrase (int) from Haemophilus phage HP1 (strain HP1c1)

KEGG orthology group: None (inferred from 93% identity to ent:Ent638_1340)

Predicted SEED Role

"Probable bacteriophage integrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>BWI76_RS09185 integrase (Klebsiella michiganensis M5al)
MAVRKLDSGKWICECYPAGRSGRRVRKQFATKGEALVFERHMIDEADAKPWLGESVDRRT
LKDVVELWFKLHGKSLTAGEHVYDKLVLMVDALGNPLATDLSSKLFAHYRDKRLTGEIYF
SEKWRKGASPVTINLEQSYLSSVFSELARLGEWAAPNPLENIRKFTIAEKEMAWLTHEQI
NELLYDCQRQSALLALVVKICLSTGARWREAVNLTRSQVTKYRITFVRTKGKKNRSIPIS
KELYEEIIALDGFKFFTDCYFQFLSVMDKASIVLPRGQLTHVLRHTFAAHFMMSGGNILA
LQKILGHHDIKMTMRYAHLAPDHLETALRFNPLATMDQLPINATHVRA