Protein Info for BWI76_RS09140 in Klebsiella michiganensis M5al

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF02798: GST_N" amino acids 2 to 76 (75 residues), 50.7 bits, see alignment E=4.6e-17 PF13417: GST_N_3" amino acids 7 to 82 (76 residues), 48.9 bits, see alignment E=1.7e-16 PF13409: GST_N_2" amino acids 10 to 78 (69 residues), 49.6 bits, see alignment E=1.2e-16 PF00043: GST_C" amino acids 123 to 196 (74 residues), 34.5 bits, see alignment E=5.2e-12 PF13410: GST_C_2" amino acids 127 to 191 (65 residues), 34.5 bits, see alignment E=4.5e-12

Best Hits

Swiss-Prot: 71% identical to GSTB_ECOL6: Glutathione S-transferase GstB (gstB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 85% identity to eae:EAE_14780)

MetaCyc: 71% identical to glutathione S-transferase GstB (Escherichia coli K-12 substr. MG1655)
RXN0-6549

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1F3 at UniProt or InterPro

Protein Sequence (208 amino acids)

>BWI76_RS09140 glutathione S-transferase (Klebsiella michiganensis M5al)
MITLWGRNNSTNVKKVRWVLEELDLPYQQILAGLEFGLNHDADYLAMNPNGLVPLLKDET
TDLVLWESNTIIRYLAAQYGQNRLWVESPAERAQGEKWMDWANGSLSPAHRPVLMGLVRT
PPEKRDPAAIEAGIAACETLFAILDDELSRHQWLSGNAFGLGDIAVAPFIYNLLEIVKTW
QPRPHLQRWYQQINQRQAWRNVVMIPVT