Protein Info for BWI76_RS09125 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 9 to 34 (26 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 145 to 162 (18 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 253 to 277 (25 residues), see Phobius details amino acids 284 to 308 (25 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 373 to 393 (21 residues), see Phobius details PF01306: LacY_symp" amino acids 6 to 398 (393 residues), 412 bits, see alignment E=5.3e-127 TIGR00882: oligosaccharide:H+ symporter" amino acids 7 to 393 (387 residues), 408.9 bits, see alignment E=1.1e-126 PF12832: MFS_1_like" amino acids 9 to 376 (368 residues), 80 bits, see alignment E=3.9e-26 PF03825: Nuc_H_symport" amino acids 12 to 296 (285 residues), 45.2 bits, see alignment E=1.4e-15 PF07690: MFS_1" amino acids 17 to 240 (224 residues), 62.4 bits, see alignment E=7.3e-21

Best Hits

KEGG orthology group: None (inferred from 91% identity to kpn:KPN_00867)

Predicted SEED Role

"Sucrose permease, major facilitator superfamily" in subsystem Sucrose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1E5 at UniProt or InterPro

Protein Sequence (414 amino acids)

>BWI76_RS09125 MFS transporter (Klebsiella michiganensis M5al)
MITPGKRNYILLSLFDFLYLFAWSSTMAFFVIWTTQHLGISATKTGLLYSVNAFIALLMQ
PFFGFISDKFGLKKRLIWILVAMLLPVGPFFIYLYAPLLVHSFWLGALLGGVYLGIIFNS
GCGVIDSYIDKISRRYQFEYGRVRMWGSLGWAAAAWIVGKYIDSNPNLAFWLASVAIVIA
AICFMLTKIELTEAEMQKSSALKVSHALELAKNGQFWMLLVFTLFVTQIYDTYDQQFAQY
FSLQFSTPEEGNRWYGILASIQVCGETLFLCLMPWFVNRTGAKWALIIAGLIMSVRIVGS
AIPLGPVWIGAVKMMHALEKPLILVSVFKFIAANFDNKLSSTVYLLVLFVASIATAIYSP
LAGYLYDTIGFAHTYYILGGIAGLFTLISVFTLRDNREPTAPGAAPGAGVAQSH