Protein Info for BWI76_RS09110 in Klebsiella michiganensis M5al

Annotation: glutathione ABC transporter permease GsiD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 103 to 128 (26 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 166 to 183 (18 residues), see Phobius details amino acids 222 to 247 (26 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details PF12911: OppC_N" amino acids 25 to 72 (48 residues), 61.4 bits, see alignment 6e-21 PF00528: BPD_transp_1" amino acids 119 to 302 (184 residues), 115.4 bits, see alignment E=2.7e-37

Best Hits

Swiss-Prot: 88% identical to GSID_SHIBS: Glutathione transport system permease protein GsiD (gsiD) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K13891, glutathione transport system permease protein (inferred from 93% identity to kpe:KPK_3701)

MetaCyc: 88% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1C2 at UniProt or InterPro

Protein Sequence (303 amino acids)

>BWI76_RS09110 glutathione ABC transporter permease GsiD (Klebsiella michiganensis M5al)
MRLLNWRRQAVINAMPGIKPGQIRTPWHEFWRRFRRQPVAMGAGIFVLLLIAVAIVAPWI
APFDAENYFDYDRLNDGPSMMHWFGVDSLGRDIFSRVLVGAQISLAAGVLAVFIGAAIGT
VLGLLAGYYEGWWDRIIMRICDVLFAFPGILLAIAVVAVMGSGMSNVIIAVAIFSIPAFA
RLVRGNTLVLKQQTFIESARSIGASDANILFNHILPGTVSSIVVYFTMRIGVSIISAASL
SFLGLGAQPPTPEWGAMLNEARADMVMAPHVALFPAIAIFLTVLAFNLLGDGLRDALDPR
IKG