Protein Info for BWI76_RS09105 in Klebsiella michiganensis M5al

Annotation: glutathione ABC transporter permease GsiC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 76 (76 residues), 64.6 bits, see alignment E=9.6e-22 PF00528: BPD_transp_1" amino acids 113 to 304 (192 residues), 143.6 bits, see alignment E=6e-46

Best Hits

Swiss-Prot: 90% identical to GSIC_SALTY: Glutathione transport system permease protein GsiC (gsiC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13890, glutathione transport system permease protein (inferred from 96% identity to kpn:KPN_00864)

MetaCyc: 91% identical to glutathione ABC transporter membrane subunit GsiC (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B174 at UniProt or InterPro

Protein Sequence (306 amino acids)

>BWI76_RS09105 glutathione ABC transporter permease GsiC (Klebsiella michiganensis M5al)
MLNYVIKRLLGLIPTLLIVAVLVFLFVHMLPGDPARLIAGPEADAQVVGMVRQQLGLDRP
LHVQFWHYISNIVQGDFGTSMASRRPVSSEIASRFMPTFWLTLASMSWAVVFGMAAGIVA
AVWRNRWPDRLGMALAVTGISFPAFALGMLLMQVFSVELGWLPTVGADSWRHYILPSLTL
GAAVAAVMARFTRASFVDVLHEDYMRTARAKGVSETLVVLKHGLRNAMIPVVTMMGLQFG
FLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEVLLFSLEFILINLVVDVLYAAIN
PAIRYK