Protein Info for BWI76_RS09095 in Klebsiella michiganensis M5al

Annotation: glutathione ABC transporter ATP-binding protein GsiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 PF00005: ABC_tran" amino acids 33 to 197 (165 residues), 91 bits, see alignment E=3.3e-29 amino acids 336 to 485 (150 residues), 109 bits, see alignment E=9.1e-35 PF08352: oligo_HPY" amino acids 248 to 282 (35 residues), 34 bits, see alignment (E = 9.6e-12) amino acids 538 to 571 (34 residues), 36.2 bits, see alignment (E = 2e-12)

Best Hits

Swiss-Prot: 80% identical to GSIA_SALTY: Glutathione import ATP-binding protein GsiA (gsiA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 88% identity to eae:EAE_14745)

MetaCyc: 80% identical to glutathione ABC transporter ATP binding subunit GsiA (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1E4 at UniProt or InterPro

Protein Sequence (617 amino acids)

>BWI76_RS09095 glutathione ABC transporter ATP-binding protein GsiA (Klebsiella michiganensis M5al)
MPHSQEIDANDVLQVRGLNVTFSQQQQAFSAVRDLSFTLRRGETLAIVGESGSGKSVTSL
ALMRLLDRAVSEVRSDALLLRRRNRQVIELSEQSDADMRGVRGADMAMIFQEPMTSLNPV
FTIGEQIAESIRLHQGLKHDEALREAKKMLDQVRIPEAEAMLSRFPHQLSGGMRQRVMIA
MALSCRPAVLIADEPTTALDVTIQAQILQLIAVLQKEMAMGVIFITHDMGVVADIADRVL
VMYRGEAVETGSVEEIFRAPQHPYTQALLAAVPRLGAMRGTSLPRRFPLLNQSPSPEEQN
TVVAGEPILKVRDLVARFPLRSGILNRITREVHAVEKVSFDLWPGETLSLVGESGCGKST
TGRALLRLVETQGGSITFNGQRIDTLTGGKLQALRRDIQFIFQDPYASLDPRQTVGYSIM
EPLRVHRLLEGDAARERVAWLLERVGLEPEHAWRYPHEFSGGQRQRICIARALALNPKVV
IADESVSALDVSIRAQIINLMLDLQREMGIAFLFISHDMAVVERISHRVAVMYRGRIVEI
GPRRAVFENPQHPYTRKLMAAVPVADPTHRRPQRVLLSDELPGNIFRRGEEGVSTPLQQV
GPGHFVARESAADVLAR