Protein Info for BWI76_RS09050 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 242 to 266 (25 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 312 to 334 (23 residues), see Phobius details amino acids 340 to 364 (25 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 20 to 196 (177 residues), 28.6 bits, see alignment E=7.1e-11 PF07690: MFS_1" amino acids 30 to 390 (361 residues), 193 bits, see alignment E=7.3e-61

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 94% identity to kpn:KPN_00853)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1J1 at UniProt or InterPro

Protein Sequence (433 amino acids)

>BWI76_RS09050 MFS transporter (Klebsiella michiganensis M5al)
MSQGLNNDMAVSKSRRIVKNLRWWMLVLFLLGVTVNYITRNSLGIIAPELKTSLGITTEQ
YSWIVGAFQLAYTIFQPLCGWLIDVIGLKLGFMICATLWAIACIAHAGAGSWLHLAILRF
FMGGAEAAATPANAKTLGEWFPKSERPIAAGWAGVGFSIGAMLAPPIIYFAHASFGWQGA
FMFTGALALVWVVLWWAFYHNPEKHPNLGKAELALIQQDNEAPPVKLPFFTALKTVSKNK
RFYGIAIPAFMAEPAWAVLSFWVPLYLAKEHGMDLKQIAMFAWLPFLAADLGSVASGYLT
KLYTRWFGCSRVNSVVASSVTGAFLMISLATVAITRDPYITIVLISIGGFGHQIISCMLS
ALVVESFDKGQMATVNGMRGSAAWIASFLFSLLIGVTADKIGFNPLFIAMGFFDLIGAVF
LVAFIAERRAKRA