Protein Info for BWI76_RS09010 in Klebsiella michiganensis M5al

Annotation: anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 81 to 106 (26 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 202 to 217 (16 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details PF03600: CitMHS" amino acids 19 to 305 (287 residues), 142 bits, see alignment E=1.3e-45

Best Hits

Swiss-Prot: 77% identical to YBIR_ECOLI: Inner membrane protein YbiR (ybiR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 88% identity to eae:EAE_14660)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1A3 at UniProt or InterPro

Protein Sequence (368 amino acids)

>BWI76_RS09010 anion transporter (Klebsiella michiganensis M5al)
MNLVFVQSLIRDRFLHLLLIIGVVLSFFVPFAPAAWLHAIDWHTIITLSGLMLLTKGIEL
SGYFDVIGRKMARRFVTERQLAIFMVLAAALLSTFLTNDVALFIVVPLTLTLKKWCAIPT
SRLIIFEALAVNAGSLLTPIGNPQNILLWGRSGLSFPAFIGQMLPLAAAMMITLLALCWF
CFPAKHLNYQSSDKAPSWRPKLVWSCLAFYLVFLTALELKQELWGLALIALGFLLLARAV
IINVDWTLLLVFMAMFIDVHLLIQLPVLQHALNGVGQLSAGGLWLTSIGLSQFISNVPAT
ILLLNYVPPSTLLAWAVNVGGFGLLPGSLANLIALRMAGDRRIWWRFHVYSLPMLLWAAL
VGYGLLQL