Protein Info for BWI76_RS08995 in Klebsiella michiganensis M5al

Annotation: sulfatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 27 to 53 (27 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details PF00884: Sulfatase" amino acids 218 to 482 (265 residues), 176.6 bits, see alignment E=3.9e-56

Best Hits

Swiss-Prot: 80% identical to OPGE_ECOLI: Phosphoethanolamine transferase OpgE (opgE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to kpe:KPK_3725)

MetaCyc: 80% identical to phosphoethanolamine transferase OpgE (Escherichia coli K-12 substr. MG1655)
RXN-15210

Predicted SEED Role

"FIG00732228: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1I1 at UniProt or InterPro

Protein Sequence (525 amino acids)

>BWI76_RS08995 sulfatase (Klebsiella michiganensis M5al)
MNVTLKETLVARGLVLNPWTGFYFLQSLFINLALGYDFSLLYTVAFTCVLHLLWRSFPRA
QKVVVGVYSLLAAMYYPFGQAYGAPNFNTLLALHATNLEESTEILTIFPWYNYLLAVFIF
ALGVIAVRRKPETSARWGKMDTLGLLFCTAIFFLQPVQNLAWGGVFKVIDTGYPAVRFVK
DVVVNNNEVLDEQARMAQLANMKDSWHVLAVKPKYHLYVVVIGESARRDALGAFGGHWDN
TPFASSVKGYLFNDYVAASGSTQKSLGLTLNRVVDDKPQFQDNFVTLANRAGFQTWWFSN
QGQIGEYDTAIASIAKRADEVQFLKNGDFEANKNTQDEQLLTLTAQVLATRRTQPQLIVL
HLMGSHPQACDRTKGKYTVFVQSKETSCYLYTMTQTDTLLSNLYTQLQNSGETFSMTYFS
DHGLAFKERGKEVQYLAHDDKYQQNFQVPFMVISSDDKAHKVIKARRSANDFLSFFSQWT
GISAQEIAPRYRFISEQKAGPTYITNFQLKKVDYTHLGTDAFTIN