Protein Info for BWI76_RS08990 in Klebsiella michiganensis M5al

Annotation: outer membrane protein X

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF06316: Ail_Lom" amino acids 8 to 113 (106 residues), 47.5 bits, see alignment E=1.9e-16 amino acids 122 to 170 (49 residues), 32.6 bits, see alignment E=6.8e-12 PF13505: OMP_b-brl" amino acids 9 to 170 (162 residues), 90 bits, see alignment E=2.2e-29

Best Hits

Swiss-Prot: 84% identical to OMPX_ENTCL: Outer membrane protein X (ompX) from Enterobacter cloacae

KEGG orthology group: K11934, outer membrane protein X (inferred from 94% identity to kpn:KPN_00843)

Predicted SEED Role

"Outer membrane protein X precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1D0 at UniProt or InterPro

Protein Sequence (170 amino acids)

>BWI76_RS08990 outer membrane protein X (Klebsiella michiganensis M5al)
MNKIARFSALAVVLAASVGTTAFAATSTVTGGYAQSDMQGEANKAGGFNLKYRYEQDNNP
LGVIGSFTYTEKDRSESGVYKKGQYYGITAGPAYRLNDWASIYGVVGVGYGKFQDNSYPN
KSDMSDYGFSYGAGLQFNPIENVALDFSYEQSRIRNVDVGTWIAGVGYRF