Protein Info for BWI76_RS08960 in Klebsiella michiganensis M5al

Annotation: mechanosensitive channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 736 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 135 to 157 (23 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 289 to 312 (24 residues), see Phobius details amino acids 332 to 358 (27 residues), see Phobius details amino acids 373 to 395 (23 residues), see Phobius details amino acids 425 to 445 (21 residues), see Phobius details amino acids 463 to 485 (23 residues), see Phobius details amino acids 506 to 527 (22 residues), see Phobius details amino acids 534 to 555 (22 residues), see Phobius details PF21088: MS_channel_1st" amino acids 513 to 553 (41 residues), 36.9 bits, see alignment 4.4e-13 PF00924: MS_channel_2nd" amino acids 554 to 618 (65 residues), 65.4 bits, see alignment E=5.9e-22 PF21082: MS_channel_3rd" amino acids 625 to 711 (87 residues), 38.9 bits, see alignment E=1.5e-13

Best Hits

Swiss-Prot: 80% identical to YBIO_ECOLI: Moderate conductance mechanosensitive channel YbiO (ybiO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 88% identity to eae:EAE_14610)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1B9 at UniProt or InterPro

Protein Sequence (736 amino acids)

>BWI76_RS08960 mechanosensitive channel protein (Klebsiella michiganensis M5al)
MPRILLLLALFFTAPLWAATLPGVPAATTDQSSSSEPDVAQKKAAYGALADVLENADARQ
ELIDQLRKAAATPPPDSTPTLTPPEIKDETTVLENVTHISREYGEQLSSRFSQLWRNITG
SPHKAFNSQTFTSAAWHFLLLAGLVFAFWWLVRLAALPLYRKMGHWGRHKNRDRSNWLQL
PATIAGAFIFDLLLLALTLFVGQLLSDRLNGNNPTIAFQQSLFLNAFALIEFFKAILRLI
FCPRIPELRPFNLSDDAAKYWNLRLSALSSLIGYGLIVAVPIISNQVNVQFGALANVVIM
LCITLWALYLIFHNKKLITQGLIHLADRSLAFFSLFIRAFALIWHWLACAYFIVLFFFSL
FDPGNSLKFMMGATLRSLAIIGAAALVSGILSRWIAKTITLSPETQRNYPELQKRLNGWI
SASLKAARILTVCVAIMLLLSAWGLFDFWQWMHNGSGQKAVDVLIRIALILFFSAIGWTL
LASLIENRLASDIHGRPLPSARARTLLTLFRNALAVVISTITIMILLSEVGVNIAPLLAG
AGALGLAISFGAQTLVKDIITGIFIQFENGMNTGDLVTIGPLTGTVERMSIRSVGVRQDT
GAYHIIPWSSITTFANFVRGIGSVVANYDVDRQEDLDKANQALKDAVAEVMAQEEIRGLI
IGEPSFAGLVGLSNTAFTLRVTFTTLPLKQWTVRFALDTQVKRHFDLAGVRAPVQTYQVL
PMPAPAGPPAPAEPTL