Protein Info for BWI76_RS08955 in Klebsiella michiganensis M5al

Annotation: 23S rRNA (adenine(1618)-N(6))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF05971: Methyltransf_10" amino acids 3 to 296 (294 residues), 476.4 bits, see alignment E=1.9e-147

Best Hits

Swiss-Prot: 87% identical to RLMF_KLEP7: Ribosomal RNA large subunit methyltransferase F (rlmF) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 90% identity to eae:EAE_14605)

MetaCyc: 80% identical to 23S rRNA m6A1618 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11596 [EC: 2.1.1.181]

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase F (EC 2.1.1.51)" (EC 2.1.1.51)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.51

Use Curated BLAST to search for 2.1.1.181 or 2.1.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B193 at UniProt or InterPro

Protein Sequence (304 amino acids)

>BWI76_RS08955 23S rRNA (adenine(1618)-N(6))-methyltransferase (Klebsiella michiganensis M5al)
MKAQKPGLHPRNRHQQRYDLPALCQAHPELQGFITLNPVGEQTIDFANPLAVKALNKALL
AHFYAVKHWDIPDGFLCPPVPGRADYLHHLADLLALDSGIIPANASILDIGVGANCIYPL
IGVHEYGWRFTGSEVNADAFASAQAIVNGNPGLTRQIRLRRQKDAKAILTGIIHKNETYD
ATLCNPPFHDSAASAQAGGERKRRNLGLGEESVLNFGGQQQELWCEGGEVAFITQMIQES
QQFGRQVKWFTSLVSRGDNLPPLYRALTDVGAVKVVKKEMAQGNKQSRFIAWTFMDEAKR
RRAL