Protein Info for BWI76_RS08945 in Klebsiella michiganensis M5al

Annotation: catecholate siderophore receptor Fiu

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 762 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF07715: Plug" amino acids 69 to 169 (101 residues), 77.7 bits, see alignment E=9.5e-26 TIGR01783: TonB-dependent siderophore receptor" amino acids 71 to 762 (692 residues), 268.3 bits, see alignment E=8.3e-84 PF00593: TonB_dep_Rec_b-barrel" amino acids 266 to 730 (465 residues), 196.1 bits, see alignment E=2.1e-61

Best Hits

Swiss-Prot: 84% identical to FIU_ECOUT: Catecholate siderophore receptor Fiu (fiu) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 84% identity to eoj:ECO26_0932)

MetaCyc: 84% identical to iron catecholate outer membrane transporter Fiu (Escherichia coli K-12 substr. MG1655)
RXN0-1721

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1H5 at UniProt or InterPro

Protein Sequence (762 amino acids)

>BWI76_RS08945 catecholate siderophore receptor Fiu (Klebsiella michiganensis M5al)
MEKNNNLPFSSFNSLTLFTGLCLSLSPSGQLLAADSTENTSGETLVVEAQTPSLYAPTRS
ADPKFSRPIADTTRTVTVVSEQVMKDQGVTNLTDALKNVPGVGAFFAGENGNSTTGDAIY
MRGADTSNSIYVDGIRDIGSVSRDTFNTEQVEVIKGPSGSDYGRSAPTGSINMISKQPRL
DSGIDASASAGSAWFRRGTLDINQAIGETSAVRLNLMGEKTHDAGRDKVKNERYGVAPSA
AFGLGTENRLYLNYLHVTQHNTPDGGIPTIGLPGYSAPNAATSALNHSGKVATSNFYGTD
SDYDDSTTDTVTMRFEHDLSDTTTIRNTTRWSRVKQDYLMTAVMGGASNITQPNPDDVGT
WTWSRLANTKDISNKILTNQTNLTSTFYTGAIGHDVSTGVEFTRETQTNYGVYPLTPPAV
NIYHPNSDISIGGLNRSGANANGQTDTFGVYAFDTLQISQDFELNGGIRLDNYQTKYDSA
SLCGGTGRGAIACPTGVAKNTPLTTVDTSTSGNLVNWKAGALYHLTDNGNLYVNYAVSQQ
PPGGSNFTLAQSGTGNSANRTDFKPQKAKTSELGTKWELMDKRLLLTAALFRTDIENEVE
QNDDGSYSQYGKKRVEGYEISLAGNITPDWQVIGGYTQQHASVREGANTAQDGTSALPYT
PEHAFTLWSQYQATDAIAVGAGARYVGSMHRGSDGAVGTPSYTEGYWVADAKVGYRINRN
LDLQLNVYNLFDTDYVASINKSGYRYHPGEPRTFLLTANIHF