Protein Info for BWI76_RS08940 in Klebsiella michiganensis M5al

Annotation: PKHD-type hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13640: 2OG-FeII_Oxy_3
  • amino acids 84 to 176 (93 residues), 50.6 bits, E=3.1e-17
• PF18331: PKHD_C
  • amino acids 182 to 224 (43 residues), 67.6 bits, 8.1e-23

Best Hits

Swiss-Prot: 82% identical to YBIX_ECO7I: PKHD-type hydroxylase YbiX (ybiX) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 82% identity to ect:ECIAI39_0781)

Predicted SEED Role

"Iron-uptake factor PiuC" in subsystem Transport of Iron

KEGG Metabolic Maps

• Benzoxazinone biosynthesis
• Diterpenoid biosynthesis
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

See A0A285B1C0 at UniProt or InterPro

Protein Sequence (225 amino acids)

>BWI76_RS08940 PKHD-type hydroxylase (Klebsiella michiganensis M5al)
MMYHIPAVLTPQEVDDFTAQLQQAEWVDGRVTTGDQGAQVKHNQQVDTRSNLYAELQGNV
LAALNRSSLFFAAALPKAISSPLFNRYQQSETYGFHVDGAVRSQAQGGWMRTDLSATLFL
SAPESYAGGELVVNDTYGQHAVKLPAGDLVLYPSSSLHCVTPVTSGVRVASFLWIQSMIR
DDKRRSMLFELDGNIQKLKSRHGESDEVLSLLNLYHNLLREWSEI