Protein Info for BWI76_RS08895 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 17 to 35 (19 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 330 to 348 (19 residues), see Phobius details amino acids 352 to 379 (28 residues), see Phobius details amino acids 388 to 412 (25 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 379 (355 residues), 187.2 bits, see alignment E=4e-59 amino acids 316 to 442 (127 residues), 58.7 bits, see alignment E=5.1e-20 PF00083: Sugar_tr" amino acids 294 to 441 (148 residues), 23.4 bits, see alignment E=2.6e-09

Best Hits

KEGG orthology group: None (inferred from 95% identity to kpu:KP1_1781)

Predicted SEED Role

"D-glucarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1G6 at UniProt or InterPro

Protein Sequence (443 amino acids)

>BWI76_RS08895 MFS transporter (Klebsiella michiganensis M5al)
MSRIDTVVCTDARKTKYRFVVLTMIFLVYAINYADRTNIGAVLPFIIDEFHINNFEAGAI
ASMFFLGYAVSQIPAGFFIAKRGTRGLVALSIFGFSAFTWLMGTVSSVFGLKMVRLGLGL
SEGPCPVGLASTINNWFPPKEKATATGVYIAATMFAPIIVPPLAVWIAVTWGWRWVFFSF
AIPGIVAAVAWYLLVKSTPAESGFVSQSELEEINAGRESDKNAVRQNILIADRFIWLDKF
IRVKKLTPIDTAKGLFTSKNILGDCLAYFMMVSVLYGLLTWIPLYLVKERGFDVMSMGFV
ASMPCIGGFIGAIGGGWISDKVLGRRRKPTMMFTAISTVVMMLIMLNIPASTWAVCVGLF
FVGLCLNIGWPAFTAYGMAVSDNKTYPIASSIINSGGNLGGFVAPMAAGFLLDQTGSFNS
VFTYFGICAAIGLVVILFLDEPQ