Protein Info for BWI76_RS08865 in Klebsiella michiganensis M5al

Annotation: ABC transporter inner membrane

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 173 to 197 (25 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 6 to 365 (360 residues), 58.8 bits, see alignment E=8.3e-20 PF12698: ABC2_membrane_3" amino acids 25 to 359 (335 residues), 171.7 bits, see alignment E=3.8e-54 PF01061: ABC2_membrane" amino acids 130 to 329 (200 residues), 118.2 bits, see alignment E=5.7e-38

Best Hits

Swiss-Prot: 93% identical to YBHR_SHIFL: Probable multidrug ABC transporter permease YbhR (ybhR) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 93% identity to ecz:ECS88_0810)

MetaCyc: 93% identical to ABC exporter membrane subunit YbhR (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-366 [EC: 7.6.2.2]

Predicted SEED Role

"ABC transport system, permease component YbhR"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B168 at UniProt or InterPro

Protein Sequence (368 amino acids)

>BWI76_RS08865 ABC transporter inner membrane (Klebsiella michiganensis M5al)
MFHRLWTLIRKELQSLLREPQTRAILIMPVLIQVLLFPFAATLEVTNATIAIYNEDNGKH
AVELTQRFARAKAFTHVLLLKSPQEIRPTIDEQKALLVVRFPADFSRNLDTNQTAPLQLL
LDGRNSNSAQIAANYLQQIVKSYQQDLLEGKAKPNNSELVVRNWYNPNLDYKWFVVPSLI
AMITTIGVMIVTSLSVAREREQGTLDQLLVSPLATWQIFIGKAVPALIVATLQATIVLGI
GIWAYQIPFAGSLLLFYFTMIVYGLSLVGFGLLISSLCSTQQQAFIGVFVFMMPAILLSG
YVSPVENMPVWLQNLTWVNPIRHFTDITKQIYLKDASLAIVWGSLWPLLVIAATTGSAAY
AMFRRKIA