Protein Info for BWI76_RS08825 in Klebsiella michiganensis M5al

Annotation: cyclic pyranopterin monophosphate synthase MoaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00581: molybdenum cofactor biosynthesis protein C
  • amino acids 4 to 152 (149 residues), 240.8 bits, E=2.2e-76
• PF01967: MoaC
  • amino acids 15 to 150 (136 residues), 196.3 bits, E=1.1e-62

Best Hits

Swiss-Prot: 96% identical to MOAC_KLEP3: Cyclic pyranopterin monophosphate synthase (moaC) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 96% identity to kpn:KPN_00812)

MetaCyc: 94% identical to cyclic pyranopterin monophosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (5/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Sequence Analysis Tools

See A0A285B115 at UniProt or InterPro

Protein Sequence (162 amino acids)

>BWI76_RS08825 cyclic pyranopterin monophosphate synthase MoaC (Klebsiella michiganensis M5al)
MSQLTHINAAGEAHMVDVSAKAETVREARAEAYVEMQAKTLAMIIDGSHHKGDVFATARI
AGIQAAKRTWELIPLCHPLMLSKVEVHLQAQPEHNRVRIESLCRLTGKTGVEMEALTAAS
VAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFKVEDSHD