Protein Info for BWI76_RS08770 in Klebsiella michiganensis M5al

Annotation: malonyl-ACP O-methyltransferase BioC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 12 to 249 (238 residues), 205.2 bits, see alignment E=7.2e-65 PF13489: Methyltransf_23" amino acids 27 to 176 (150 residues), 48.4 bits, see alignment E=2.6e-16 PF01209: Ubie_methyltran" amino acids 44 to 154 (111 residues), 28.9 bits, see alignment E=2.2e-10 PF13649: Methyltransf_25" amino acids 46 to 134 (89 residues), 72 bits, see alignment E=1.6e-23 PF13847: Methyltransf_31" amino acids 46 to 142 (97 residues), 39.3 bits, see alignment E=1.7e-13 PF08242: Methyltransf_12" amino acids 47 to 136 (90 residues), 46.8 bits, see alignment E=1.3e-15 PF08241: Methyltransf_11" amino acids 47 to 138 (92 residues), 86.3 bits, see alignment E=5.3e-28

Best Hits

Swiss-Prot: 65% identical to BIOC_ENTLS: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Enterobacter lignolyticus (strain SCF1)

KEGG orthology group: None (inferred from 78% identity to eae:EAE_14455)

MetaCyc: 64% identical to malonyl-acyl carrier protein methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11475 [EC: 2.1.1.197]

Predicted SEED Role

"Biotin synthesis protein BioC"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.197

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0Z8 at UniProt or InterPro

Protein Sequence (251 amino acids)

>BWI76_RS08770 malonyl-ACP O-methyltransferase BioC (Klebsiella michiganensis M5al)
MTAVNKRAIAAAFGRAAGHYTQHDELQRLSASLLLEQLDIKTFPEVLDAGCGPGSVSRFW
RDAGSRVTALDLSVDMLAEARRGNCAHRYVEGDIEALPLADGSVDLAWSNLAVQWCDNLA
TAIDELSRVVRPGGRVAFSTLLSGSLPELNQAWRAIDARPHANRFLSEQAVHQALAGRRA
SGHVHAITLPFADALSAMRSLKGIGATHLHHGRGAATLSRGKLRQLQLAWPQQQGQCPLT
YHLFTGVIERD