Protein Info for BWI76_RS08695 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 239 to 255 (17 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details PF04940: BLUF" amino acids 2 to 92 (91 residues), 85.1 bits, see alignment E=3.1e-28 PF00563: EAL" amino acids 166 to 387 (222 residues), 164 bits, see alignment E=4.1e-52

Best Hits

KEGG orthology group: None (inferred from 75% identity to eae:EAE_14360)

Predicted SEED Role

"Hypothetical protein ycgF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0Z6 at UniProt or InterPro

Protein Sequence (407 amino acids)

>BWI76_RS08695 hypothetical protein (Klebsiella michiganensis M5al)
MLTTIIYRSHICDNVSIKSLDSMVAEANVKNGQEEVSGILLFNGTHFFQLLEGPEEKVEG
IYRRICTDPRHHNLVELLRDHGPTRRFGKIGMELFDLREYDRDEVLQVVLDKGTTKYQLT
YDDRALHFFRTFVEATEKENYYEIPAAESWDFVTEGEASYPDTPLARAECSFAFQPVIDP
FAKEIVSVEALLRTPSGESPAVYFDGLSREEMYSTDLLSKRIAFAMAGRLRLRGRTLSIN
LLPMTLVNIPGAVEFLLTEIESNGLIPEQIIVEFTESEAISRVDEFTDSVRKLKSAGIRV
AIDHFGAGFAGLLLLAQFQPDRIKINRQLVKDIHKHGPKQAIVQAIIKCCNSLEIAISAV
GVEQPEEWMWLESAGIIHFQGNLFARPCLGGIPAVAWPEKKTAWELL