Protein Info for BWI76_RS08675 in Klebsiella michiganensis M5al

Annotation: GntR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 PF00392: GntR" amino acids 20 to 82 (63 residues), 56.7 bits, see alignment E=1.6e-19 PF00155: Aminotran_1_2" amino acids 170 to 438 (269 residues), 67.8 bits, see alignment E=1e-22

Best Hits

KEGG orthology group: K00375, GntR family transcriptional regulator / MocR family aminotransferase (inferred from 55% identity to ent:Ent638_1108)

Predicted SEED Role

"Transcriptional regulator, GntR family domain / Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B125 at UniProt or InterPro

Protein Sequence (489 amino acids)

>BWI76_RS08675 GntR family transcriptional regulator (Klebsiella michiganensis M5al)
MPKPIAPLFQELLLPRGVIKDQVYHALRNAILDGRLTAGSKIPSSRALAEMMAISRNSVI
SGFDRLMDEGYLVTRKGAGTFVCEHIPDSVISEYESSPQPETAIAAAGPLNPDVAALLPS
WSEREESGEMRQVFAVGIGCTDLFPHALWGRLLGRVWRQSRRELGAHATAYGYLPLRQAI
SHYIQATRGVNCHEDRVIIVNGIQQALAITAQVLLEKGDEVWLDDPGYNGARGAFAARGA
VVRPVRVDGEGMDIQDGIRHYPQAKLVYTAPSHQFPLSGTLSLPRRLALLEWAQANRAWI
FEDDYNSEFRYAARSLQALQGLDKHQRVIYSGTFSKMMYPEFRLGFLVVPEHLREQFAMT
KYYTDLCSGYLEQAVLARFIREGHYASHVRRIRKACFERKSALEAAIERYFAGRMRVHPT
DSGVHIVCWLADGLKAKEVVAKARQIGLGVQSFERYCQRPMSREGVLFGFANHPPEVLLD
GVRRLAGVL