Protein Info for BWI76_RS08635 in Klebsiella michiganensis M5al

Annotation: molybdenum-dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR00637: ModE molybdate transport repressor domain" amino acids 16 to 113 (98 residues), 136.7 bits, see alignment E=2.4e-44 PF00126: HTH_1" amino acids 20 to 83 (64 residues), 29.8 bits, see alignment E=4.6e-11 TIGR00638: molybdenum-pterin binding domain" amino acids 123 to 192 (70 residues), 86 bits, see alignment E=1.3e-28 PF03459: TOBE" amino acids 125 to 187 (63 residues), 53 bits, see alignment E=3.3e-18 amino acids 198 to 258 (61 residues), 45.5 bits, see alignment E=7e-16

Best Hits

Swiss-Prot: 82% identical to MODE_ECOLI: DNA-binding transcriptional dual regulator ModE (modE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_14310)

Predicted SEED Role

"DNA-binding domain of ModE / Molybdate-binding domain of ModE" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B143 at UniProt or InterPro

Protein Sequence (262 amino acids)

>BWI76_RS08635 molybdenum-dependent transcriptional regulator (Klebsiella michiganensis M5al)
MQAEILLTLKLQQRLFADPRRIALLKQIDQTGSISQGAKNAGISYKSAWDAINDMNQLSE
QPLVDRATGGKGGGGAVLTRYGQRLIQLYDLLAQIQQKAFDVLSDDDALPLDSLLAAISR
FSLQTSARNQWFGTITGRDHQQVQQHVEVLLADGQTRFKVAITAQSADRLGLAEGQEVLV
LLKAPWVGMTQDAALAQQADNQLAGRIIHIERGPEQCEVLMALPDGQSLCATLPLEQTRD
LAEGAEAIAYFNADRIILATLC