Protein Info for BWI76_RS08590 in Klebsiella michiganensis M5al

Annotation: zinc transporter ZitB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 83 to 107 (25 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 155 to 179 (25 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 18 to 293 (276 residues), 318.2 bits, see alignment E=2.4e-99 PF01545: Cation_efflux" amino acids 21 to 213 (193 residues), 173.5 bits, see alignment E=2.3e-55

Best Hits

Swiss-Prot: 75% identical to ZITB_SALTY: Zinc transporter ZitB (zitB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 86% identity to kpu:KP1_1708)

MetaCyc: 75% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Zinc transporter ZitB" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B190 at UniProt or InterPro

Protein Sequence (314 amino acids)

>BWI76_RS08590 zinc transporter ZitB (Klebsiella michiganensis M5al)
MGQSHSHRSPPSAEDKNARRLLLAFCVTAGFMLIEVAGGLISGSLALLADAGHMLTDAAA
LLFAFLAVRFASRPPNAQHTFGWLRLTTLAAFLNAIALVVITILIVWEAIQRFHHPQPVA
GKTMMIIAVAGLLANILAFWILHRGSEERNLNVRAAALHVLGDLLGSVGAIIAAIVILTT
GWTPIDPILSVLVSCLVLRSAWRLLQESVNELLEGAPRSLNVDALKRDLRRSIPEVRDVH
HVHAWLVGEKTVMTLHVQVVPPHDHDGLLDRILDFLEHKYEIEHITVQMEYQPCSGPECR
LNMTHAGHGHHHHH