Protein Info for BWI76_RS08545 in Klebsiella michiganensis M5al

Annotation: cell division protein CpoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 37 to 105 (69 residues), 78 bits, see alignment E=1.4e-25 TIGR02795: tol-pal system protein YbgF" amino acids 141 to 257 (117 residues), 134.5 bits, see alignment E=1.4e-43 PF13174: TPR_6" amino acids 155 to 173 (19 residues), 16.9 bits, see alignment (E = 2.4e-06) amino acids 179 to 210 (32 residues), 26.1 bits, see alignment 2.8e-09 amino acids 215 to 246 (32 residues), 28.1 bits, see alignment 6.2e-10 PF13432: TPR_16" amino acids 157 to 211 (55 residues), 32.7 bits, see alignment E=2.5e-11 amino acids 191 to 246 (56 residues), 20.8 bits, see alignment E=1.3e-07

Best Hits

Swiss-Prot: 85% identical to CPOB_ECOLI: Cell division coordinator CpoB (cpoB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to kpn:KPN_00746)

MetaCyc: 85% identical to cell division coordinator CpoB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B108 at UniProt or InterPro

Protein Sequence (261 amino acids)

>BWI76_RS08545 cell division protein CpoB (Klebsiella michiganensis M5al)
MSSNFRHHLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVTQLERISNAHSQLLTQLQ
QQLSDNQSDIDSLRGQIQESQYQLNQVVERQKQILLQIDGLSSGGGATGAQTQTSAGDQG
AAASAPAASSGAPASTGDANTDYNAAIALVKDPSRQDDAMAAFQNFVKKYPDSTYQPNAN
YWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAPDAMFKVGVIMQDKGDTAKAKAVYQQV
VSKFPGTDGAKQAQKRLNALG