Protein Info for BWI76_RS08540 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02802: peptidoglycan-associated lipoprotein" amino acids 72 to 174 (103 residues), 156.4 bits, see alignment E=1e-50 PF00691: OmpA" amino acids 73 to 168 (96 residues), 77.4 bits, see alignment E=4.6e-26

Best Hits

Swiss-Prot: 94% identical to PAL_ECO57: Peptidoglycan-associated lipoprotein (pal) from Escherichia coli O157:H7

KEGG orthology group: K03640, peptidoglycan-associated lipoprotein (inferred from 98% identity to kpe:KPK_3825)

Predicted SEED Role

"18K peptidoglycan-associated outer membrane lipoprotein; Peptidoglycan-associated lipoprotein precursor; Outer membrane protein P6; OmpA/MotB precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0W0 at UniProt or InterPro

Protein Sequence (174 amino acids)

>BWI76_RS08540 hypothetical protein (Klebsiella michiganensis M5al)
MQLNKVLKGLLIALPVMAIAACSSNKNASNDQSGEGMLGAGTGMDGNANGGNMSSEEQAR
LQMQQLQQNNIVYFDLDKYDIRSDFAAMLDAHANFLRSNPSYKVTVEGHADERGTPEYNI
ALGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYAKNRRAVLVY