Protein Info for BWI76_RS08520 in Klebsiella michiganensis M5al

Annotation: colicin transporter TolQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details TIGR02796: protein TolQ" amino acids 2 to 216 (215 residues), 311.4 bits, see alignment E=1.7e-97 PF01618: MotA_ExbB" amino acids 76 to 204 (129 residues), 133.8 bits, see alignment E=1.6e-43

Best Hits

Swiss-Prot: 96% identical to TOLQ_SHIFL: Tol-Pal system protein TolQ (tolQ) from Shigella flexneri

KEGG orthology group: K03562, biopolymer transport protein TolQ (inferred from 96% identity to eco:b0737)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B117 at UniProt or InterPro

Protein Sequence (227 amino acids)

>BWI76_RS08520 colicin transporter TolQ (Klebsiella michiganensis M5al)
MNILDLFLKASLLVKLIMLILVCFSIASWAIIIQRTRILNSASREAEAFEDKFWSGIELS
RLYQESQGRRDNLTGSEQIFYSGFKEFARLHRANSHAPEAIVEGASRAMRISMNRELESL
ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF
AAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQAFTSSESNKG