Protein Info for BWI76_RS08490 in Klebsiella michiganensis M5al

Annotation: methylaspartate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR01501: methylaspartate mutase, S subunit" amino acids 3 to 136 (134 residues), 237.8 bits, see alignment E=1.2e-75 PF02310: B12-binding" amino acids 6 to 97 (92 residues), 49.9 bits, see alignment E=1.4e-17

Best Hits

Swiss-Prot: 91% identical to GMSS_ECO57: Glutamate mutase sigma subunit (glmS) from Escherichia coli O157:H7

KEGG orthology group: K01846, methylaspartate mutase [EC: 5.4.99.1] (inferred from 96% identity to ses:SARI_02198)

MetaCyc: 45% identical to glutamate mutase alpha subunit (Haloarcula marismortui)
Methylaspartate mutase. [EC: 5.4.99.1]

Predicted SEED Role

"Methylaspartate mutase, S subunit (EC 5.4.99.1)" (EC 5.4.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.99.1

Use Curated BLAST to search for 5.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B120 at UniProt or InterPro

Protein Sequence (149 amino acids)

>BWI76_RS08490 methylaspartate mutase (Klebsiella michiganensis M5al)
MKKSTLVIGVIGADCHAVGNKVLDRVFTAHDFRVINLGVMVSQDEYIDAAIETGADAIVV
SSIYGHGDIDCLGLRERCIERGIGDILLYVGGNLVVGKHDFADVEAKFKEMGFNRVFAPS
HDLEDVCQLMANDINQRHGVEQQCLEEAI