Protein Info for BWI76_RS08430 in Klebsiella michiganensis M5al

Annotation: succinate--CoA ligase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 TIGR01019: succinate-CoA ligase, alpha subunit" amino acids 4 to 287 (284 residues), 483.2 bits, see alignment E=1.4e-149 PF02629: CoA_binding" amino acids 6 to 99 (94 residues), 112.4 bits, see alignment E=3e-36 PF13607: Succ_CoA_lig" amino acids 145 to 284 (140 residues), 45.2 bits, see alignment E=1.6e-15 PF00549: Ligase_CoA" amino acids 151 to 271 (121 residues), 98.8 bits, see alignment E=5.4e-32

Best Hits

Swiss-Prot: 96% identical to SUCD_ECO57: Succinate--CoA ligase [ADP-forming] subunit alpha (sucD) from Escherichia coli O157:H7

KEGG orthology group: K01902, succinyl-CoA synthetase alpha subunit [EC: 6.2.1.5] (inferred from 97% identity to cko:CKO_02429)

MetaCyc: 96% identical to succinyl-CoA synthetase subunit alpha (Escherichia coli K-12 substr. MG1655)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B113 at UniProt or InterPro

Protein Sequence (289 amino acids)

>BWI76_RS08430 succinate--CoA ligase subunit alpha (Klebsiella michiganensis M5al)
MSVLINKDTKVICQGFTGSQGTFHSEQAIAYGTQMVGGVTPGKGGTTHLGLPVFNTVREA
VEATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMI
GPNCPGVITPGECKIGIMPGHIHQPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGG
DPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAYIKDHVTKPVVGYIAGVTAP
KGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVIK