Protein Info for BWI76_RS08375 in Klebsiella michiganensis M5al

Annotation: pyroglutamyl-peptidase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF01470: Peptidase_C15" amino acids 4 to 202 (199 residues), 264.1 bits, see alignment E=5.5e-83 TIGR00504: pyroglutamyl-peptidase I" amino acids 4 to 211 (208 residues), 287.7 bits, see alignment E=3.4e-90

Best Hits

Swiss-Prot: 78% identical to PCP_KLEP3: Pyrrolidone-carboxylate peptidase (pcp) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 85% identity to eae:EAE_14135)

Predicted SEED Role

"Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)" in subsystem ZZ gjo need homes (EC 3.4.19.3)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.19.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0T8 at UniProt or InterPro

Protein Sequence (214 amino acids)

>BWI76_RS08375 pyroglutamyl-peptidase I (Klebsiella michiganensis M5al)
MAGVLITGFEPFGGEAVNPSWEVVKRLDGAIIAGQPVVARQLPCVFGDALTALNAALDEL
KPVLTLAIGQAGGRVDITVERVAINVDDARIPDNKGLQPIDVPIVAGGPAAYFSTLPIKA
IVTALRSKGIPASVSQTAGTFVCNHVMYGLLHSLRHRSGAKGGFIHIPYLPEQAAAHPGE
ASMAVDTVRAALETAIAVALQQDGDVKVGGGATH