Protein Info for BWI76_RS08370 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 53 (18 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 221 to 238 (18 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 267 to 293 (27 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details PF06166: DUF979" amino acids 7 to 330 (324 residues), 396.5 bits, see alignment E=4.1e-123

Best Hits

KEGG orthology group: None (inferred from 91% identity to eae:EAE_14130)

Predicted SEED Role

"FIG001614: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B157 at UniProt or InterPro

Protein Sequence (331 amino acids)

>BWI76_RS08370 membrane protein (Klebsiella michiganensis M5al)
MNFQQTWLYWLAGVVLLVVAVMSWRDKANPRRLTTGLFWGLYGLVFLFGDWTYELVGDKR
TVNIGVGVVVVVLALIAGFGGVRLGRYHQRSQEERTASAARLGNRLFFPALAIPVVTVIG
VLLFNNLPSLQVAIFGPGNHATLITLFSMTAGTLLGLVMAIRMTHETAAQPLQEARRLLD
SVGWAFILPQILAVLGLLFTAAGVGNSISWLTQHYLAVDSRFIAVAVYTLGMALLTMVMG
NAFAAFPIVTAGVGIPILVLQHGGNPAVMAAIGMFSGYCGTLMTPMAANFNIVPAALLEL
PDKNAVIKAQVPTGVMLLIVNVFLLYFLMFL