Protein Info for BWI76_RS08365 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 28 to 49 (22 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 163 to 186 (24 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details PF06149: DUF969" amino acids 8 to 225 (218 residues), 305.5 bits, see alignment E=1e-95

Best Hits

KEGG orthology group: None (inferred from 92% identity to kpu:KP1_1678)

Predicted SEED Role

"FIG015373: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0Z2 at UniProt or InterPro

Protein Sequence (241 amino acids)

>BWI76_RS08365 membrane protein (Klebsiella michiganensis M5al)
MGESLSLWPLIGIAAIVVGFVLRFNPVLVVIVSGIITGLTAHMPIATILEKLGEGFLNTR
NLPFILLLPLAVIGLLERHGLKERAQMWIAKIRSATAGRLLIVYLFVREVTAAMGLTSLG
GHPQMVRPLLAPMAEGAAEKNFGALPGEVRYRLRAMSAATDNVGLFFGEDIFVAFGAIIF
MHNFMLESGGIQTEPLHIALWGIPTAVCAFLIHSARLWRLDRHLQRELDKVNAGQAKGGA
V