Protein Info for BWI76_RS08350 in Klebsiella michiganensis M5al
Annotation: carboxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 81% identical to PXPB_ECO57: 5-oxoprolinase subunit B (pxpB) from Escherichia coli O157:H7
KEGG orthology group: None (inferred from 87% identity to kpn:KPN_00722)MetaCyc: 81% identical to 5-oxoprolinase component B (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]
Predicted SEED Role
"Allophanate hydrolase 2 subunit 1 (EC 3.5.1.54)" (EC 3.5.1.54)
MetaCyc Pathways
- 5-oxo-L-proline metabolism (6/6 steps found)
- allantoin degradation IV (anaerobic) (8/9 steps found)
- uracil degradation III (5/5 steps found)
- L-citrulline degradation (3/3 steps found)
- urea degradation I (3/3 steps found)
- γ-glutamyl cycle (5/6 steps found)
- superpathway of allantoin degradation in yeast (5/6 steps found)
- L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
- cyanate degradation (2/3 steps found)
- cyanuric acid degradation II (3/5 steps found)
- cyanuric acid degradation I (2/5 steps found)
- superpathway of atrazine degradation (3/8 steps found)
KEGG Metabolic Maps
- Arginine and proline metabolism
- Atrazine degradation
- Glutathione metabolism
- Urea cycle and metabolism of amino groups
Isozymes
Compare fitness of predicted isozymes for: 3.5.1.54
Use Curated BLAST to search for 3.5.1.54 or 3.5.2.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (218 amino acids)
>BWI76_RS08350 carboxylase (Klebsiella michiganensis M5al) MQRARCYLLGETAVVLELEPPVTLESQKRIWRLAQRLVGHTEVVEAIPGMNNITVILRNP QQTAWDAIERLQLWWEECDTLEPESRQVSVPVVYGGEYGPDLGEIARHSGLSEKQVVELH SSVEYVVWFLGFQPGFPYFGGLPEKLAMPRRAEPRLLVPAGSVGIGGAQTGIYPLATPGG WQLLGRTPLALFDPKRKEPVLLRSGDRVRFVPQKEGVC