Protein Info for BWI76_RS08340 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 267 to 284 (18 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details amino acids 409 to 431 (23 residues), see Phobius details amino acids 459 to 479 (21 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 6 to 472 (467 residues), 259.5 bits, see alignment E=3.6e-81 PF07690: MFS_1" amino acids 22 to 423 (402 residues), 62.7 bits, see alignment E=3.1e-21 PF00854: PTR2" amino acids 77 to 443 (367 residues), 326.5 bits, see alignment E=2.4e-101

Best Hits

Swiss-Prot: 91% identical to DTPD_KLEP3: Dipeptide permease D (dtpD) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 93% identity to eae:EAE_14100)

MetaCyc: 87% identical to dipeptide:H+ symporter DtpD (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-288

Predicted SEED Role

"Di/tripeptide permease YbgH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0W8 at UniProt or InterPro

Protein Sequence (493 amino acids)

>BWI76_RS08340 MFS transporter (Klebsiella michiganensis M5al)
MNTQSSQPRAIYYVVALQIWEYFSFYGMRALLILYLTNQLKYDDNHAYALFSAYCSLVYV
TPILGGFLADKLLGNRMAVMLGALLMAIGHLVLGASEIAPTFLYLSLAIIVCGYGLFKSN
VSCLLGELYEPTDPRRDGGFSLMYAAGNVGSIIAPIACGYVQEEYSWAMGFALAAVGMIA
GLVIFLSGNRHFRHTRGVNREALRARSFVLPNWGWLLVLLIAAPLLITVLFWQEWSVYAL
IVATVIGLAVLTRIYLRAETAGQRKDLRLIMVLTCFSLLFWAFAQQGGSSISLYIDRFVN
RHFMGYEIPTAMFQSVNAFAVMLCGVVLAWLVKENINGNRTVRIWGKFALGLGLMSAGFC
ILTLSARWSAAYGHSSMPLMVLGLAVMGFAELFIDPVAMSQITRIQIPGVTGVLTGIYML
LSGAIANYLAGVIADQTSQGSFDAAGAINYSINAYIEVFSQITWGALACVGLVLAIWLYH
SVKIRARRLAMES