Protein Info for BWI76_RS08290 in Klebsiella michiganensis M5al

Annotation: phosphoglucomutase, alpha-D-glucose phosphate-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 TIGR01132: phosphoglucomutase, alpha-D-glucose phosphate-specific" amino acids 1 to 544 (544 residues), 1059.3 bits, see alignment E=0 PF02878: PGM_PMM_I" amino acids 40 to 179 (140 residues), 111.9 bits, see alignment E=4.1e-36 PF02879: PGM_PMM_II" amino acids 210 to 317 (108 residues), 59 bits, see alignment E=1.2e-19 PF02880: PGM_PMM_III" amino acids 320 to 440 (121 residues), 108.4 bits, see alignment E=4.6e-35 PF00408: PGM_PMM_IV" amino acids 489 to 539 (51 residues), 27.6 bits, see alignment 4.9e-10

Best Hits

Swiss-Prot: 95% identical to PGM_ECOLI: Phosphoglucomutase (pgm) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_14060)

MetaCyc: 95% identical to phosphoglucomutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucomutase. [EC: 5.4.2.2]

Predicted SEED Role

"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0U4 at UniProt or InterPro

Protein Sequence (546 amino acids)

>BWI76_RS08290 phosphoglucomutase, alpha-D-glucose phosphate-specific (Klebsiella michiganensis M5al)
MAIDKRAGQPAQQSDLINVAQLTAQYYVLKPEVGNAEHAVKFGTSGHRGSAARHNFNEQH
ILAIAQAIAEDRAKNGIAGPCYVGKDTHALSEPAFISVLEVLAANGVDVIVQENNGFTPT
PAISNAILVHNKKDGPLADGIVITPSHNPPEDGGIKYNPPNGGPADTNVTKVVENRANEL
LAAGLQGVKRISLDAALASGHVKEQDLVQPFIEGLADIVDMAAIQKAGLTLGVDPLGGSG
IEYWKRIAEHYNLNLTIVNDHVDQTFRFMHLDKDGAIRMDCSSECAMAGLLALRDKFDLA
FANDPDYDRHGIVTPAGLMNPNHYLAVAINYLFQHRPQWGKDVAVGKTLVSSAMIDRVVN
DLGRKLVEVPVGFKWFVDGLFDGSFGFGGEESAGASFLRFDGTPWSTDKDGIIMCLLAAE
ITAVTGKNPQQHYDELAERFGAPSYNRLQASATSAQKAALSKLSPEMVSASTLAGDPITA
RLTAAPGNGAAIGGLKVMTDNGWFAARPSGTEDAYKIYCESFLGAEHRQQIEKEAVEIVS
EVLKNA