Protein Info for BWI76_RS08270 in Klebsiella michiganensis M5al

Annotation: flavodoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details TIGR01752: flavodoxin" amino acids 37 to 201 (165 residues), 254.8 bits, see alignment E=1.4e-80 PF12641: Flavodoxin_3" amino acids 39 to 157 (119 residues), 34.8 bits, see alignment E=2.2e-12 PF00258: Flavodoxin_1" amino acids 39 to 193 (155 residues), 106.7 bits, see alignment E=1.8e-34 PF12724: Flavodoxin_5" amino acids 39 to 122 (84 residues), 28.1 bits, see alignment E=3.6e-10

Best Hits

Swiss-Prot: 98% identical to FLAV_KLEPN: Flavodoxin (fldA) from Klebsiella pneumoniae

KEGG orthology group: K03839, flavodoxin I (inferred from 91% identity to sed:SeD_A0801)

MetaCyc: 97% identical to flavodoxin 1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Flavodoxin 1" in subsystem Flavodoxin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0V8 at UniProt or InterPro

Protein Sequence (209 amino acids)

>BWI76_RS08270 flavodoxin (Klebsiella michiganensis M5al)
MLFPRPSLFCYHCPYLRALRHYHIIKFQEVILLMAIIGIFFGSDTGNTENIAKMIQKQLG
KDVADVHDIAKSSKEDLEGHDILLLGIPTWYYGEAQCDWDDFFPTLEEIDFNGKLVALFG
CGDQEDYAEYFCDALGTIRDIIEPRGATIVGHWPTAGYHFEASKGLADDDHFVGLAIDED
RQPELTNERVEKWVKQISEELHLEEIKNA