Protein Info for BWI76_RS08255 in Klebsiella michiganensis M5al

Annotation: tricarballylate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 TIGR02485: precorrin 3B synthase CobZ" amino acids 2 to 458 (457 residues), 677.4 bits, see alignment E=4e-208 PF00890: FAD_binding_2" amino acids 3 to 429 (427 residues), 104.1 bits, see alignment E=3.6e-33 PF12831: FAD_oxidored" amino acids 3 to 158 (156 residues), 36.1 bits, see alignment E=1.8e-12 PF01266: DAO" amino acids 3 to 119 (117 residues), 32.7 bits, see alignment E=2.1e-11 PF13450: NAD_binding_8" amino acids 6 to 62 (57 residues), 22.4 bits, see alignment 4.1e-08

Best Hits

KEGG orthology group: K13796, tricarballylate dehydrogenase (inferred from 96% identity to kpe:KPK_3866)

MetaCyc: 88% identical to propane-1,2,3-tricarboxylate dehydrogenase (Salmonella enterica enterica serovar Typhimurium str. LT2)
1.3.8.M1 [EC: 1.3.8.M1]

Predicted SEED Role

"TcuA: flavoprotein used to oxidize tricarballylate to cis-aconitate" in subsystem Tricarballylate Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0Q4 at UniProt or InterPro

Protein Sequence (467 amino acids)

>BWI76_RS08255 tricarballylate dehydrogenase (Klebsiella michiganensis M5al)
MVDVLVIGGGNAALCAALTAREAGASVLLLEAAPREWRGGNSQHTRNLRCMHDAPQDVLI
DSYPEEEYWQDLLRVTEGNTNEALARLVIRTSAQCRDWMRQHGVNFQPPLSGALHVARTN
AFFMGGGKALVNAYYRSAEQMGVKIRYNTPVQALELDNGEFVAALAGEERIVAKTCVLAA
GGFESNREWLREAWGQNDRGEWPADNFLIRGTRFNQGVLLKFMIDAGADIIGDPSQSHCV
AIDARAPLYDGGICTRVDCVSLGVVVNRDARRFYDEGEDFWPKRYAIWGRLVAHQPGQIG
YSIIDSKAIGHFMPPVFPGAQANTIEELARQLGLDAESLAQTIARYNAACAPGQFDHTRL
DNCATSGLTPPKTHWARPIDTPPYYGYALRPGITFTYLGLYVNEHAAVHFAGKPSRSLFV
AGEMMAGNVLGKGYTAGVGMSIGTTFGRIAGQQAARAALQERHHEVA