Protein Info for BWI76_RS08250 in Klebsiella michiganensis M5al

Annotation: tricarballylate utilization protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 114 to 135 (22 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 304 to 321 (18 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details TIGR02484: CitB domain protein" amino acids 15 to 376 (362 residues), 390.7 bits, see alignment E=3.7e-121

Best Hits

Swiss-Prot: 90% identical to CITB_ECOLX: Citrate utilization protein B (citB) from Escherichia coli

KEGG orthology group: None (inferred from 93% identity to eae:EAE_14020)

MetaCyc: 87% identical to FADH2:quinone oxidoreductase (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN-20072

Predicted SEED Role

"TcuB: works with TcuA to oxidize tricarballylate to cis-aconitate" in subsystem Tricarballylate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0T9 at UniProt or InterPro

Protein Sequence (379 amino acids)

>BWI76_RS08250 tricarballylate utilization protein B (Klebsiella michiganensis M5al)
MKSLEKLIIDAQIITQPEAEVERVMQVCNACRYCEGFCAVFPAMTQRLAFGKADINYLAN
LCHNCGACLHACQYAPPHEFAINVPKAMAEVRLETYQHYAQPAAFGSLYRRAGVTTALAL
VGGLILFLLLAMGLKGSLLHPPLAGDFYQIFPHNLLAWMFGSVFVLAMGLLMAGVIRFWR
EISPGHPHAVDIAKASHNALTLKYLDGGHGKGCNEADDAFTLMRRRFHHLTFYGFLLCFA
ATLVATGYHYFAGWEAPYPFFSAPVLLGTLGGIGLLVGPAGLLWLNLRRSPLHGDPRQKP
MDRAFILLLLLTNFTGLALLAGRDTSWMGILLAIHLGVVMALFLTLPYGKFAHGFYRCAA
LLKWAIEKRRGKQAAVAGD