Protein Info for BWI76_RS08245 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 49 to 75 (27 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 111 to 139 (29 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details amino acids 400 to 419 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 18 to 227 (210 residues), 97.7 bits, see alignment E=7.4e-32 amino acids 223 to 406 (184 residues), 29.5 bits, see alignment E=3.8e-11 PF07690: MFS_1" amino acids 19 to 380 (362 residues), 116.7 bits, see alignment E=1.1e-37 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 20 to 409 (390 residues), 476.8 bits, see alignment E=2.9e-147

Best Hits

Swiss-Prot: 92% identical to CITA_ECOLX: Citrate-proton symporter (citA) from Escherichia coli

KEGG orthology group: None (inferred from 95% identity to eae:EAE_14015)

MetaCyc: 92% identical to propane-1,2,3-tricarboxylate-proton symporter (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-49

Predicted SEED Role

"TcuC: integral membrane protein used to transport tricarballylate across the cell membrane" in subsystem Tricarballylate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B0N7 at UniProt or InterPro

Protein Sequence (431 amino acids)

>BWI76_RS08245 MFS transporter (Klebsiella michiganensis M5al)
MTQPSSRAGTIGAILRVTSGNFLEQFDFFLFGFYATYIARTFFPAESEFAALMLTFAVFG
SGFLMRPIGAIVLGAYIDRIGRRKGLMVTLAIMGCGTLLIALVPGYQTIGILAPILVVVG
RLLQGFSAGVELGGVSVYLSEIATPGNKGFYTSWQSASQQVAIVVAALIGYALNETLGHD
QIAEWGWRIPFFIGCMIIPLIFVLRRSLQETEAFLQRKHRPDTREILSTIVKNWRIISAG
TLLVAMTTTTFYFITVYTPTYGRAVLHLSARDSLLVTMLVGISNFIWLPIGGAISDKIGR
RPVLMGITLLALLTTWPVMHWLTAAPDFTRMTLVLLWFSFFFGMYNGAMVAALTEVMPVY
VRTVGFSLAFSLATAIFGGLTPAISTALVEITGDKSSPGWWLMCAALCGFAATAMLFVRL
SRGYRPAEIPR