Protein Info for BWI76_RS08190 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 272 to 296 (25 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details amino acids 417 to 438 (22 residues), see Phobius details PF13347: MFS_2" amino acids 14 to 443 (430 residues), 152 bits, see alignment E=9.5e-49

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>BWI76_RS08190 MFS transporter (Klebsiella michiganensis M5al)
MSNPVAIKLKTYIGYGMTDLFSSGAFAIIAAWLMYFFTNFSGLTPIQAGSILFIAKIIDT
VVSPCVGYLTDNIGNTRLGKRFGRRRIFLLLGAVLVYVYSLLWIPGMPYFYYMVVYVSVE
IIAALVIIPWETLASEMTDDYKQRSILSAMRLFYGGFSTWLATFLPGRLFAHFGTSDSRV
FFINGVIFSIIFMIALLMTWSTTWERKQETSDQVESPRRFSLKDVFAGMASTLRIRCFRQ
HLTMYVLSFTSLDLFYTVFIYFIIYSLSGTAILASNLLAVGIFLTGWSNALLAWAVIRYG
QTLCLKVCLIVSLMCFFVFGGFYLWKPLLMLPMMYATSLVYQFFKGGYVYIIWNIYPFIP
DIDELVTRKRREGVFAGIMTLARKSTSALAGMLIGIVLQLVHFDASSTTQSLTTVHGITG
LFFLGNVLLLLVSTLIAFRFKLSKENHQIVKDEISRLKNGGQLADTDPQVKSVLFSLTGI
EHEKLWPAKNT